Chikungunya NSP3 Recombinant Protein

Product Name: Chikungunya NSP3 Recombinant Protein

Catalogue No.: 117069

Alternate Names: Nonstructural protein-3, NSP-3, Nonstructural protein 3

Description: This recombinant protein is expressed in E. coli with thioredoxin tag at N-
terminal (119aa) and His-tag (6aa) at C-terminal. NSP3 protein is 300aa long.

Sequence: KAVYKKWPESFKNSATPVGTAKTVMCGTYPVIHAVGPNFSNYSESEGDRELAAAYREVAKEVT
RLGVNSVAIPLLSTGVYSGGKDRLTQSLNHLFTAMDSTDADVVIYCRDKEWEKKISEAIQMRTQ
VELLDEHISIDCDIVRVHPDSSLAGRKGYSTTEGALYSYLEGTRFHQTAVDMAEIHTMWPKQTE
ANEQVCLYALGESIESIRQKCPVDDADASSPPKTVPCLCRYAMTPERVTRLRMNHVTSIIVCSSF
PLPKYKIEGVQKVKCSKVMLFDHNVPSRVSPREYRSSQESAQEA

Type: Recombinant protein

Source: Produced in E. coli

Concentration: 1.0mg/mL

Purity: Affinity purified protein to >95% (by SDS PAGE).

Format: Provided as a sterile filtered solution in PBS, pH 7.2. No other additives.

Uses: ELISA, WB. Not tested for other uses.

Storage: Store at 4^oC in fridge a for short term use. Aliquot and store at -20^oC or -80^oC for long term storage. Avoid repeated freeze thaw cycles.

Shipping: Antibody is shipped on ice pack at ambient temperature.